BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10654 883271 883002 -90 !not a gene! (90 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71101 hypothetical protein PH1068 - Pyrococcus horikoshii ... 80 5e-15 >pir||A71101 hypothetical protein PH1068 - Pyrococcus horikoshii >gi|3257484|dbj|BAA30167.1| (AP000004) 158aa long hypothetical protein [Pyrococcus horikoshii] Length = 158 Score = 80.0 bits (194), Expect = 5e-15 Identities = 38/53 (71%), Positives = 44/53 (82%) Query: 1 MLFMLEYLNPQETPRLRSFIPSSSVLAPTCRIGLLTKSQSCPSLCFLIASRTS 53 MLFMLEYLNPQET + SF SS VLAPT R+GLLT++ SCP LCFL+AS+TS Sbjct: 106 MLFMLEYLNPQETAKFTSFTASSRVLAPTWRMGLLTRNHSCPLLCFLMASKTS 158 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.136 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32439095 Number of Sequences: 2977 Number of extensions: 1015910 Number of successful extensions: 2070 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2069 Number of HSP's gapped (non-prelim): 1 length of query: 90 length of database: 189,106,746 effective HSP length: 51 effective length of query: 39 effective length of database: 158,583,909 effective search space: 6184772451 effective search space used: 6184772451 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 158 (66.0 bits)