BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10699 870644 870381 -88 !not a gene! (88 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71104 hypothetical protein PH1092 - Pyrococcus horikoshii ... 112 8e-25 >pir||A71104 hypothetical protein PH1092 - Pyrococcus horikoshii >gi|3257508|dbj|BAA30191.1| (AP000004) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 112 bits (277), Expect = 8e-25 Identities = 58/85 (68%), Positives = 63/85 (73%) Query: 4 MVAAMNGLSLSSILSPVGSTPENINLASFTIFGESKSKTGLVWSKRPGQSPVVSRTPSNS 63 MV A GLS +SI SPVG PEN +LASF I ES+S TG S PGQSPVV RTPS Sbjct: 1 MVPATKGLSFTSIFSPVGRIPENTSLASFIILVESRSNTGFACSINPGQSPVVKRTPSKL 60 Query: 64 NSRAVLSSEIIARAFLSLPVTWGIT 88 NS AVLSSE+IA+AFLS PVTWGIT Sbjct: 61 NSTAVLSSEVIAKAFLSFPVTWGIT 85 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.127 0.360 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31512582 Number of Sequences: 2977 Number of extensions: 1079244 Number of successful extensions: 1932 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1931 Number of HSP's gapped (non-prelim): 1 length of query: 88 length of database: 189,106,746 effective HSP length: 56 effective length of query: 32 effective length of database: 155,591,474 effective search space: 4978927168 effective search space used: 4978927168 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (22.0 bits) S2: 157 (65.6 bits)