BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10729 864443 864255 -63 !not a gene! (63 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71102 hypothetical protein PH1082 - Pyrococcus horikoshii ... 73 5e-13 >pir||G71102 hypothetical protein PH1082 - Pyrococcus horikoshii >gi|3257498|dbj|BAA30181.1| (AP000004) 105aa long hypothetical protein [Pyrococcus horikoshii] Length = 105 Score = 72.6 bits (175), Expect = 5e-13 Identities = 38/63 (60%), Positives = 45/63 (71%) Query: 1 MLSSRRGLSINSRGIRKNKLSTVLSLSVCSRNIAPPPGFRTLTISFIALSGFGTVQKTKD 60 MLSS +GL+I+S G R + LSLSVCSRN+ P GF+TL IS +A GFG VQKTKD Sbjct: 1 MLSSIKGLNISSNGARNSMFIRKLSLSVCSRNMTFPLGFKTLIISLMAFFGFGIVQKTKD 60 Query: 61 ETT 63 E T Sbjct: 61 EIT 63 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.132 0.361 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20666521 Number of Sequences: 2977 Number of extensions: 530477 Number of successful extensions: 1297 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1296 Number of HSP's gapped (non-prelim): 1 length of query: 63 length of database: 189,106,746 effective HSP length: 42 effective length of query: 21 effective length of database: 163,970,292 effective search space: 3443376132 effective search space used: 3443376132 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)