BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10732 863300 863046 -85 !not a gene! (85 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71134 hypothetical protein PH0838 - Pyrococcus horikoshii ... 96 5e-20 >pir||B71134 hypothetical protein PH0838 - Pyrococcus horikoshii >gi|3257249|dbj|BAA29932.1| (AP000003) 117aa long hypothetical protein [Pyrococcus horikoshii] Length = 117 Score = 96.3 bits (236), Expect = 5e-20 Identities = 53/81 (65%), Positives = 56/81 (68%), Gaps = 3/81 (3%) Query: 5 SLCNSGFFIPIISMYSENERGMTSIVFPCPLLPGKSSMSFLTFRELEPVIVITSFSKRPA 64 SLC FF PI YS ERG+TS V P PLLPG +SMS LT ELEPV VITSFSK P Sbjct: 28 SLC---FFSPITLAYSGKERGITSKVLPPPLLPGNNSMSLLTRSELEPVTVITSFSKSPE 84 Query: 65 SISGLTPRHQPSKKVTSSRKM 85 SI GLTP H PS + SSRKM Sbjct: 85 SIRGLTPLHHPSSEEASSRKM 105 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.135 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29503437 Number of Sequences: 2977 Number of extensions: 986737 Number of successful extensions: 2208 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2207 Number of HSP's gapped (non-prelim): 1 length of query: 85 length of database: 189,106,746 effective HSP length: 52 effective length of query: 33 effective length of database: 157,985,422 effective search space: 5213518926 effective search space used: 5213518926 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 157 (65.6 bits)