BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10782 849940 849677 -88 !not a gene! (88 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71073 hypothetical protein PH1281 - Pyrococcus horikoshii ... 80 5e-15 >pir||F71073 hypothetical protein PH1281 - Pyrococcus horikoshii >gi|3257701|dbj|BAA30384.1| (AP000005) 189aa long hypothetical protein [Pyrococcus horikoshii] Length = 189 Score = 80.0 bits (194), Expect = 5e-15 Identities = 41/83 (49%), Positives = 57/83 (68%), Gaps = 4/83 (4%) Query: 1 MASVHVKEDRPYLRAISVGYNHFVTPRDNFSYLLCSFLNVLHHLLVRSLLTPLLKGVSSE 60 ++ +H+KE+RP LR+++V YN FVTPR+ SYL F VLHHL++ L LL+ VSS+ Sbjct: 106 LSRIHMKENRPNLRSVTVSYNDFVTPRNYLSYLFSRFPYVLHHLIISPFLPSLLECVSSQ 165 Query: 61 GYDDSLRHEIPPIFSRRLLIKAF 83 G ++SL HEI P R L K+F Sbjct: 166 GDNNSLGHEISP----RTLWKSF 184 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.143 0.429 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32553683 Number of Sequences: 2977 Number of extensions: 1098796 Number of successful extensions: 2770 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2768 Number of HSP's gapped (non-prelim): 2 length of query: 88 length of database: 189,106,746 effective HSP length: 48 effective length of query: 40 effective length of database: 160,379,370 effective search space: 6415174800 effective search space used: 6415174800 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 158 (66.0 bits)