BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10869 828453 828178 -92 !not a gene! (92 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71074 hypothetical protein PH1289 - Pyrococcus horikoshii ... 96 1e-19 >pir||F71074 hypothetical protein PH1289 - Pyrococcus horikoshii >gi|3257709|dbj|BAA30392.1| (AP000005) 115aa long hypothetical protein [Pyrococcus horikoshii] Length = 115 Score = 95.6 bits (234), Expect = 1e-19 Identities = 50/74 (67%), Positives = 57/74 (76%), Gaps = 1/74 (1%) Query: 20 IGFMPIPSAFTMYVGSFPSSLSFSAMCIAMFPPISSSPVNANMTFPSSF-SLTRSLKASI 78 +GF+PIPSA MY+G+ PS SFSAMCIA+ PPISSSPVNA +T P SF SL S AS+ Sbjct: 1 MGFIPIPSALIMYLGTLPSFESFSAMCIAIAPPISSSPVNAKITLPFSFSSLESSFNASM 60 Query: 79 RDATFPLSSALPLP 92 AT PLSSALPLP Sbjct: 61 TAATLPLSSALPLP 74 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.136 0.396 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31734468 Number of Sequences: 2977 Number of extensions: 1167730 Number of successful extensions: 3456 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3454 Number of HSP's gapped (non-prelim): 1 length of query: 92 length of database: 189,106,746 effective HSP length: 52 effective length of query: 40 effective length of database: 157,985,422 effective search space: 6319416880 effective search space used: 6319416880 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 158 (66.0 bits)