BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10949 805779 805519 -87 !not a gene! (87 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71087 hypothetical protein PH0959 - Pyrococcus horikoshii ... 123 6e-28 >pir||B71087 hypothetical protein PH0959 - Pyrococcus horikoshii >gi|3257373|dbj|BAA30056.1| (AP000004) 140aa long hypothetical protein [Pyrococcus horikoshii] Length = 140 Score = 123 bits (305), Expect = 6e-28 Identities = 56/63 (88%), Positives = 58/63 (91%) Query: 1 MNNDYSFLHFSFLPIPRSSLFNLLLYSPYGSSGENLGGWATLVFSPHTGQVSLSVYLPHF 60 MNN+Y FLHFSFLPIPRSSLFNLLLYSPYGSSGENLGG ATLVFSPHTG +SL VYLPH Sbjct: 28 MNNNYGFLHFSFLPIPRSSLFNLLLYSPYGSSGENLGGCATLVFSPHTGHISLRVYLPHL 87 Query: 61 GHF 63 GHF Sbjct: 88 GHF 90 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.143 0.465 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26977046 Number of Sequences: 2977 Number of extensions: 933232 Number of successful extensions: 1651 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1650 Number of HSP's gapped (non-prelim): 1 length of query: 87 length of database: 189,106,746 effective HSP length: 44 effective length of query: 43 effective length of database: 162,773,318 effective search space: 6999252674 effective search space used: 6999252674 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 158 (66.0 bits)