BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11097 747812 747651 -54 !not a gene! (54 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC11662.1| (AL445064) conserved hypothetical membrane prote... 82 6e-16 >emb|CAC11662.1| (AL445064) conserved hypothetical membrane protein [Thermoplasma acidophilum] Length = 171 Score = 82.3 bits (200), Expect = 6e-16 Identities = 42/52 (80%), Positives = 43/52 (81%) Query: 3 SFTNLTCLTASTMFPVPASPFVLIIAAPSQILLTASPRFLAPQTKGAVNFFL 54 SFT L CLTAS MFPVPASPFVLIIAAPS IL TAS RFLAP+T G V FFL Sbjct: 120 SFTFLICLTASMMFPVPASPFVLIIAAPSNILRTASGRFLAPETTGTVRFFL 171 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.138 0.409 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17992215 Number of Sequences: 2977 Number of extensions: 483618 Number of successful extensions: 1401 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1400 Number of HSP's gapped (non-prelim): 1 length of query: 54 length of database: 189,106,746 effective HSP length: 33 effective length of query: 21 effective length of database: 169,356,675 effective search space: 3556490175 effective search space used: 3556490175 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 156 (65.2 bits)