BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11287 684642 684424 -73 !not a gene! (73 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71016 hypothetical protein PH1425 - Pyrococcus horikoshii ... 85 1e-16 >pir||C71016 hypothetical protein PH1425 - Pyrococcus horikoshii >gi|3257848|dbj|BAA30531.1| (AP000006) 194aa long hypothetical protein [Pyrococcus horikoshii] Length = 194 Score = 84.7 bits (206), Expect = 1e-16 Identities = 40/66 (60%), Positives = 50/66 (75%) Query: 8 LLEHVSYVTGCKYSWNLCSHVHVNLYVAVFIRYAEVLHEISFRLVTYEDENSIDFLLEGF 67 LLEHVSYV+ +YSWNL SHVH+N V +FI Y ++L+E+ RLVTYE E++ID LL F Sbjct: 85 LLEHVSYVSCSEYSWNLSSHVHINWNVTIFICYPQMLNEVRLRLVTYEYEDTIDLLLNRF 144 Query: 68 SSFNVL 73 S NVL Sbjct: 145 SRLNVL 150 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.140 0.438 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27677810 Number of Sequences: 2977 Number of extensions: 878020 Number of successful extensions: 2245 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2244 Number of HSP's gapped (non-prelim): 1 length of query: 73 length of database: 189,106,746 effective HSP length: 46 effective length of query: 27 effective length of database: 161,576,344 effective search space: 4362561288 effective search space used: 4362561288 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 157 (65.6 bits)