BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11300 682118 681822 -99 !not a gene! (99 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75113 hypothetical protein PAB2415 - Pyrococcus abyssi (st... 67 5e-11 >pir||D75113 hypothetical protein PAB2415 - Pyrococcus abyssi (strain Orsay) >gi|5458132|emb|CAB49621.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 235 Score = 67.1 bits (161), Expect = 5e-11 Identities = 39/96 (40%), Positives = 55/96 (56%), Gaps = 11/96 (11%) Query: 1 MKRALAFLSLMVIFASLMVALSPKYGIKFGLGGEDWKRYRYTDDYYINHGLEEVGGMNIV 60 +KR LA +++++I L L+ + FG + YY+NH E+ G +N V Sbjct: 2 LKRVLAIITILIIGYWLAEGLA---NVPFG------QDKMLVGQYYLNHVKEQTGAVNAV 52 Query: 61 TDIVFDYRGYDTLGEATVLFTAIAGAVALLRPWRRE 96 T +V +YRG+DTLGE TVLF A G ALL WRR+ Sbjct: 53 TAVVVNYRGFDTLGEVTVLFIASTGVAALL--WRRK 86 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.143 0.437 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36235399 Number of Sequences: 2977 Number of extensions: 1406324 Number of successful extensions: 10933 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10933 Number of HSP's gapped (non-prelim): 1 length of query: 99 length of database: 189,106,746 effective HSP length: 47 effective length of query: 52 effective length of database: 160,977,857 effective search space: 8370848564 effective search space used: 8370848564 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 159 (66.3 bits)