BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11404 656626 656384 -81 !not a gene! (81 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71021 hypothetical protein PH1462 - Pyrococcus horikoshii ... 113 2e-25 >pir||A71021 hypothetical protein PH1462 - Pyrococcus horikoshii >gi|3257886|dbj|BAA30569.1| (AP000006) 483aa long hypothetical protein [Pyrococcus horikoshii] Length = 483 Score = 113 bits (281), Expect = 2e-25 Identities = 59/82 (71%), Positives = 66/82 (79%), Gaps = 1/82 (1%) Query: 1 MIGVVSFTDPRETALSDEREKAIMEKHNYIIKELS-EFEVLDINKELGKPRNGIFGINSI 59 MIGV SFTDPRETALS ERE+AI EKH ++KELS EFEVLDIN LGK +FGINS+ Sbjct: 1 MIGVASFTDPRETALSSEREEAIKEKHEKLVKELSKEFEVLDINARLGKYSKDVFGINSV 60 Query: 60 KEAITAGRIAKERGVSGVIIGL 81 EAI AGRIAK G+SGVI+GL Sbjct: 61 DEAIKAGRIAKSEGLSGVILGL 82 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.139 0.370 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27349097 Number of Sequences: 2977 Number of extensions: 890224 Number of successful extensions: 2531 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2528 Number of HSP's gapped (non-prelim): 1 length of query: 81 length of database: 189,106,746 effective HSP length: 54 effective length of query: 27 effective length of database: 156,788,448 effective search space: 4233288096 effective search space used: 4233288096 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.5 bits) S2: 157 (65.6 bits)