BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11509 627877 627620 -86 !not a gene! (86 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71025 hypothetical protein PH1499 - Pyrococcus horikoshii ... 123 3e-28 >pir||G71025 hypothetical protein PH1499 - Pyrococcus horikoshii >gi|3257924|dbj|BAA30607.1| (AP000006) 102aa long hypothetical protein [Pyrococcus horikoshii] Length = 102 Score = 123 bits (307), Expect = 3e-28 Identities = 60/69 (86%), Positives = 63/69 (90%) Query: 1 MFAHFLPIPGSFISSSNLSGTLPLYFSKIILEVSTIHLPLLLHNPTFKLLRKFCISSTLA 60 MFAHFLPIPGS ISSSNLSGTLPLYF +IILEVSTIH PLLLH PTFKL RKFCISSTLA Sbjct: 1 MFAHFLPIPGSLISSSNLSGTLPLYFFRIILEVSTIHFPLLLHRPTFKLFRKFCISSTLA 60 Query: 61 LAIASMLGY 69 LA+ SM+GY Sbjct: 61 LAMLSMVGY 69 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.143 0.420 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23202520 Number of Sequences: 2977 Number of extensions: 673287 Number of successful extensions: 1970 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1969 Number of HSP's gapped (non-prelim): 1 length of query: 86 length of database: 189,106,746 effective HSP length: 49 effective length of query: 37 effective length of database: 159,780,883 effective search space: 5911892671 effective search space used: 5911892671 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 158 (66.0 bits)