BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs11677 577636 577397 -80 !not a gene! (80 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F72623 hypothetical protein APE1446 - Aeropyrum pernix (str... 74 2e-13 >pir||F72623 hypothetical protein APE1446 - Aeropyrum pernix (strain K1) >gi|5105130|dbj|BAA80444.1| (AP000061) 182aa long hypothetical protein [Aeropyrum pernix] Length = 182 Score = 74.1 bits (179), Expect = 2e-13 Identities = 43/77 (55%), Positives = 48/77 (61%) Query: 4 TLTIFPGTMTIFSRFRALLSLMPLSITLANSIALSSGGPGSKVGEAKGTSSTLVVITPMF 63 T T PG +T SR A SL LS TLA+SIA SSGGPGSK G A+GT+S V TP F Sbjct: 106 THTFSPGLITRLSRSTAPTSLKLLSTTLASSIAFSSGGPGSKTGLARGTNSAWTVKTPWF 165 Query: 64 GVSGKGSPRLVFIPTKT 80 GVS KG+P P T Sbjct: 166 GVSLKGAPTPALTPAIT 182 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.134 0.371 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27878197 Number of Sequences: 2977 Number of extensions: 935736 Number of successful extensions: 3252 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3251 Number of HSP's gapped (non-prelim): 1 length of query: 80 length of database: 189,106,746 effective HSP length: 54 effective length of query: 26 effective length of database: 156,788,448 effective search space: 4076499648 effective search space used: 4076499648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)