BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs12359 394905 394729 -59 !not a gene!
         (59 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||D71115 hypothetical protein PH0691 - Pyrococcus horikoshii ...    98  2e-20

>pir||D71115 hypothetical protein PH0691 - Pyrococcus horikoshii
           >gi|3257099|dbj|BAA29782.1| (AP000003) 439aa long
           hypothetical protein [Pyrococcus horikoshii]
           Length = 439
           
 Score = 97.5 bits (239), Expect = 2e-20
 Identities = 39/59 (66%), Positives = 52/59 (88%)

Query: 1   MSYDVEETETKRREVDALLRASKALKCNNLTVITWDYEGVETHGDRRIKFIPLWRWLLG 59
           +SY +E+ ETK+REV+ALLRAS+ LKCNNLTV+TWDYEG E +  +R++F+PLW+WLLG
Sbjct: 381 VSYSIEDIETKQREVEALLRASRLLKCNNLTVVTWDYEGTEVYKGKRVRFVPLWKWLLG 439


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.321    0.137    0.436 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21260078
Number of Sequences: 2977
Number of extensions: 556069
Number of successful extensions: 1136
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1135
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 189,106,746
effective HSP length: 38
effective length of query: 21
effective length of database: 166,364,240
effective search space: 3493649040
effective search space used: 3493649040
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.8 bits)
S2: 156 (65.2 bits)