BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs12524 347238 347035 -68 !not a gene!
         (68 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A71190 hypothetical protein PH1793 - Pyrococcus horikoshii ...   124  1e-28

>pir||A71190 hypothetical protein PH1793 - Pyrococcus horikoshii
          >gi|3258229|dbj|BAA30912.1| (AP000007) 139aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 139
          
 Score =  124 bits (308), Expect = 1e-28
 Identities = 61/68 (89%), Positives = 65/68 (94%)

Query: 1  MSFSLAYLIVIIFPSAPLAPNPPGTIIPSTPSRSFVPCSSISSASIHLIFTLTSLLTLAC 60
          +SFSLAYLIVIIFPSAPLAPNPPGTIIPSTPS + VPCSS+SSASIHLI TLTSLLTLAC
Sbjct: 6  ISFSLAYLIVIIFPSAPLAPNPPGTIIPSTPSSNLVPCSSMSSASIHLILTLTSLLTLAC 65

Query: 61 FRASFMLR 68
          F+ASFMLR
Sbjct: 66 FKASFMLR 73


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.329    0.138    0.411 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24748776
Number of Sequences: 2977
Number of extensions: 804268
Number of successful extensions: 5408
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5407
Number of HSP's gapped (non-prelim): 1
length of query: 68
length of database: 189,106,746
effective HSP length: 47
effective length of query: 21
effective length of database: 160,977,857
effective search space: 3380534997
effective search space used: 3380534997
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.8 bits)
S2: 156 (65.2 bits)