BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs12524 347238 347035 -68 !not a gene! (68 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71190 hypothetical protein PH1793 - Pyrococcus horikoshii ... 124 1e-28 >pir||A71190 hypothetical protein PH1793 - Pyrococcus horikoshii >gi|3258229|dbj|BAA30912.1| (AP000007) 139aa long hypothetical protein [Pyrococcus horikoshii] Length = 139 Score = 124 bits (308), Expect = 1e-28 Identities = 61/68 (89%), Positives = 65/68 (94%) Query: 1 MSFSLAYLIVIIFPSAPLAPNPPGTIIPSTPSRSFVPCSSISSASIHLIFTLTSLLTLAC 60 +SFSLAYLIVIIFPSAPLAPNPPGTIIPSTPS + VPCSS+SSASIHLI TLTSLLTLAC Sbjct: 6 ISFSLAYLIVIIFPSAPLAPNPPGTIIPSTPSSNLVPCSSMSSASIHLILTLTSLLTLAC 65 Query: 61 FRASFMLR 68 F+ASFMLR Sbjct: 66 FKASFMLR 73 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.138 0.411 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24748776 Number of Sequences: 2977 Number of extensions: 804268 Number of successful extensions: 5408 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5407 Number of HSP's gapped (non-prelim): 1 length of query: 68 length of database: 189,106,746 effective HSP length: 47 effective length of query: 21 effective length of database: 160,977,857 effective search space: 3380534997 effective search space used: 3380534997 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 156 (65.2 bits)