BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs12932 237951 237787 -55 !not a gene! (55 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71249 hypothetical protein PH0248 - Pyrococcus horikoshii ... 81 1e-15 >pir||A71249 hypothetical protein PH0248 - Pyrococcus horikoshii >gi|3256637|dbj|BAA29320.1| (AP000001) 105aa long hypothetical protein [Pyrococcus horikoshii] Length = 105 Score = 81.1 bits (197), Expect = 1e-15 Identities = 38/55 (69%), Positives = 45/55 (81%) Query: 1 MLSPCLTESASTACPKASWMNTPASSGSIMIGISPEGGDLADKRDSALLEMKLAQ 55 MLS C T SAS ACP+ASWM TPA+SGSI+ ISPEGGDLA+ +++A LE KLAQ Sbjct: 31 MLSSCFTASASLACPRASWMKTPANSGSIITCISPEGGDLAESKETAFLETKLAQ 85 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.310 0.124 0.357 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19923916 Number of Sequences: 2977 Number of extensions: 547872 Number of successful extensions: 1960 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1959 Number of HSP's gapped (non-prelim): 1 length of query: 55 length of database: 189,106,746 effective HSP length: 34 effective length of query: 21 effective length of database: 168,758,188 effective search space: 3543921948 effective search space used: 3543921948 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 156 (65.2 bits)