BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs13485 93362 93123 -80 !not a gene! (80 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71230 hypothetical protein PH0100 - Pyrococcus horikoshii ... 80 3e-15 >pir||B71230 hypothetical protein PH0100 - Pyrococcus horikoshii >gi|3256486|dbj|BAA29169.1| (AP000001) 115aa long hypothetical protein [Pyrococcus horikoshii] Length = 115 Score = 80.4 bits (195), Expect = 3e-15 Identities = 43/80 (53%), Positives = 47/80 (58%) Query: 1 MLFFSSIASTLNVPKSSFDNSLSFSARPSLSLTNFTLPIVTCGINFSSLLKPSFERXXXX 60 +LFFSSIAST PKSSF +SLSF RPSLSLTNFTLP V C S LKPSF Sbjct: 36 VLFFSSIASTTKDPKSSFASSLSFMVRPSLSLTNFTLPRVICATKLPSFLKPSFASSSSI 95 Query: 61 XXXXXXXXXXXXTPAQITLI 80 PAQ+TL+ Sbjct: 96 SLAISLIISSFSIPAQMTLM 115 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.132 0.368 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20574927 Number of Sequences: 2977 Number of extensions: 547417 Number of successful extensions: 1118 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1117 Number of HSP's gapped (non-prelim): 1 length of query: 80 length of database: 189,106,746 effective HSP length: 54 effective length of query: 26 effective length of database: 156,788,448 effective search space: 4076499648 effective search space used: 4076499648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 156 (65.2 bits)