BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs13582 74546 74334 -71 !not a gene! (71 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71227 hypothetical protein PH0079 - Pyrococcus horikoshii ... 121 8e-28 >pir||E71227 hypothetical protein PH0079 - Pyrococcus horikoshii >gi|3256465|dbj|BAA29148.1| (AP000001) 149aa long hypothetical protein [Pyrococcus horikoshii] Length = 149 Score = 121 bits (301), Expect = 8e-28 Identities = 60/68 (88%), Positives = 61/68 (89%) Query: 1 MPPLNSKALIPVPDPTAPSSKSSLAFFIASTTCSLFTCLPLMSLRYESLHSRTSGFTEPV 60 +PPLNSKALIPVP PTAPSSKSS A FIASTTCSL TCLPLMSLRYESLHS T G TEPV Sbjct: 79 IPPLNSKALIPVPAPTAPSSKSSSALFIASTTCSLLTCLPLMSLRYESLHSSTRGLTEPV 138 Query: 61 VTPMSSFS 68 VTPMSSFS Sbjct: 139 VTPMSSFS 146 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.128 0.374 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25914636 Number of Sequences: 2977 Number of extensions: 766286 Number of successful extensions: 2462 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2461 Number of HSP's gapped (non-prelim): 1 length of query: 71 length of database: 189,106,746 effective HSP length: 50 effective length of query: 21 effective length of database: 159,182,396 effective search space: 3342830316 effective search space used: 3342830316 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)