BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs13800 255675 255860 62 !not a gene! (62 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71452 hypothetical protein PH0273 - Pyrococcus horikoshii ... 95 1e-19 >pir||B71452 hypothetical protein PH0273 - Pyrococcus horikoshii >gi|3256662|dbj|BAA29345.1| (AP000001) 233aa long hypothetical protein [Pyrococcus horikoshii] Length = 233 Score = 94.8 bits (232), Expect = 1e-19 Identities = 40/62 (64%), Positives = 48/62 (76%) Query: 1 MVYPFSPFLYELRYWGIFARSFQELYPALPNLYNCHLNLLVWHFFNLFNLKSKPFPNLNS 60 +VYPFS FL EL YWG+F+ Q+L PNLY+C+LN L+W FFNLFNLKSKPFP+ NS Sbjct: 41 VVYPFSSFLDELCYWGVFSCGLQQLNSVFPNLYDCYLNFLIWDFFNLFNLKSKPFPDFNS 100 Query: 61 LF 62 F Sbjct: 101 FF 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.333 0.149 0.523 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26710246 Number of Sequences: 2977 Number of extensions: 891647 Number of successful extensions: 2127 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2126 Number of HSP's gapped (non-prelim): 1 length of query: 62 length of database: 189,106,746 effective HSP length: 38 effective length of query: 24 effective length of database: 166,364,240 effective search space: 3992741760 effective search space used: 3992741760 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 156 (65.2 bits)