BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs13828 565827 565654 -58 !not a gene! (58 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71034 hypothetical protein PH1561 - Pyrococcus horikoshii ... 74 2e-13 >pir||A71034 hypothetical protein PH1561 - Pyrococcus horikoshii >gi|3257990|dbj|BAA30673.1| (AP000006) 130aa long hypothetical protein [Pyrococcus horikoshii] Length = 130 Score = 73.7 bits (178), Expect = 2e-13 Identities = 37/58 (63%), Positives = 41/58 (69%) Query: 1 MPRSLLISLGVLPFFKSSSIIMRVLYEYFLGLPLPFSTGITFIPICSSARKTFLETFG 58 +P LLISLGV P S I +VL EYFLGLPLPFSTG+ IPICS A TFL+T G Sbjct: 3 IPSVLLISLGVFPLLSISFITSKVLVEYFLGLPLPFSTGMILIPICSRALITFLDTLG 60 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.332 0.148 0.443 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19303273 Number of Sequences: 2977 Number of extensions: 542434 Number of successful extensions: 1320 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1319 Number of HSP's gapped (non-prelim): 1 length of query: 58 length of database: 189,106,746 effective HSP length: 37 effective length of query: 21 effective length of database: 166,962,727 effective search space: 3506217267 effective search space used: 3506217267 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 156 (65.2 bits)