BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs2487 21754 22047 98 !not a gene! (98 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E72756 hypothetical protein APE0042 - Aeropyrum pernix (str... 76 1e-13 >pir||E72756 hypothetical protein APE0042 - Aeropyrum pernix (strain K1) >gi|5103430|dbj|BAA78951.1| (AP000058) 110aa long hypothetical protein [Aeropyrum pernix] Length = 110 Score = 75.7 bits (183), Expect = 1e-13 Identities = 43/80 (53%), Positives = 50/80 (61%) Query: 12 VTSLSPKYILPSVGSSKPAIILSVVVFPQPLGPRRTKNSPSLIVRFSLFTAVKFPNFLVK 71 +TS ILPS G S+PA+ SVVVFPQPLGPRRTKNSPSL++R + TA PN L Sbjct: 1 MTSSPSISILPSSGYSRPAMSRSVVVFPQPLGPRRTKNSPSLMLRSTWSTATTLPNLLTT 60 Query: 72 FSSLTSTILITSRLYPTSLP 91 SSL S I + P P Sbjct: 61 PSSLISAIQASPLRSPADKP 80 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.138 0.398 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35719061 Number of Sequences: 2977 Number of extensions: 1282573 Number of successful extensions: 2365 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2364 Number of HSP's gapped (non-prelim): 1 length of query: 98 length of database: 189,106,746 effective HSP length: 52 effective length of query: 46 effective length of database: 157,985,422 effective search space: 7267329412 effective search space used: 7267329412 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 159 (66.3 bits)