BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs2489 22209 22436 76 !not a gene! (76 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F72543 hypothetical protein APE1634 - Aeropyrum pernix (str... 74 2e-13 >pir||F72543 hypothetical protein APE1634 - Aeropyrum pernix (strain K1) >gi|5105322|dbj|BAA80635.1| (AP000062) 155aa long hypothetical protein [Aeropyrum pernix] Length = 155 Score = 73.7 bits (178), Expect = 2e-13 Identities = 39/70 (55%), Positives = 46/70 (65%) Query: 3 KVNIAAAANPGKASGRVMLLNAPHLVNPKTIPASSSSLSTPANMLDVIRTTKGNAMAVWA 62 KVN+ AA PG ASGRV+L N L P +PASS SL P N+ VI TTKG A+AVWA Sbjct: 46 KVNMPAAVRPGAASGRVILRNTMMLERPNIMPASSRSLGIPPNIEPVIITTKGRAIAVWA 105 Query: 63 KATPRRVSIK 72 +A P VS + Sbjct: 106 RARPISVSFR 115 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.124 0.349 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26003083 Number of Sequences: 2977 Number of extensions: 777285 Number of successful extensions: 2345 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2344 Number of HSP's gapped (non-prelim): 1 length of query: 76 length of database: 189,106,746 effective HSP length: 55 effective length of query: 21 effective length of database: 156,189,961 effective search space: 3279989181 effective search space used: 3279989181 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)