BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs2489 22209 22436 76 !not a gene!
         (76 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||F72543 hypothetical protein APE1634 - Aeropyrum pernix (str...    74  2e-13

>pir||F72543 hypothetical protein APE1634 - Aeropyrum pernix (strain K1)
           >gi|5105322|dbj|BAA80635.1| (AP000062) 155aa long
           hypothetical protein [Aeropyrum pernix]
           Length = 155
           
 Score = 73.7 bits (178), Expect = 2e-13
 Identities = 39/70 (55%), Positives = 46/70 (65%)

Query: 3   KVNIAAAANPGKASGRVMLLNAPHLVNPKTIPASSSSLSTPANMLDVIRTTKGNAMAVWA 62
           KVN+ AA  PG ASGRV+L N   L  P  +PASS SL  P N+  VI TTKG A+AVWA
Sbjct: 46  KVNMPAAVRPGAASGRVILRNTMMLERPNIMPASSRSLGIPPNIEPVIITTKGRAIAVWA 105

Query: 63  KATPRRVSIK 72
           +A P  VS +
Sbjct: 106 RARPISVSFR 115


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.316    0.124    0.349 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26003083
Number of Sequences: 2977
Number of extensions: 777285
Number of successful extensions: 2345
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2344
Number of HSP's gapped (non-prelim): 1
length of query: 76
length of database: 189,106,746
effective HSP length: 55
effective length of query: 21
effective length of database: 156,189,961
effective search space: 3279989181
effective search space used: 3279989181
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 156 (65.2 bits)