BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs2503 30192 30413 74 !not a gene! (74 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71221 hypothetical protein PH0029 - Pyrococcus horikoshii ... 68 2e-11 >pir||B71221 hypothetical protein PH0029 - Pyrococcus horikoshii >gi|3256414|dbj|BAA29097.1| (AP000001) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 67.5 bits (162), Expect = 2e-11 Identities = 32/65 (49%), Positives = 46/65 (70%) Query: 10 PSPQMARPNVGRSVAQCVGSPTSRIPSWCLQSLDVNRELTSPPKDLAGPLNALSKNCSNT 69 PSP++ PN+ +A+ V + RIP QSL+VNREL +P KDLAGPLN+LS++ ++T Sbjct: 5 PSPEVTCPNICSCIAKPVSPSSPRIPGRGFQSLNVNRELATPSKDLAGPLNSLSEHRTDT 64 Query: 70 FPLSY 74 FP + Sbjct: 65 FPFRH 69 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.131 0.408 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29226662 Number of Sequences: 2977 Number of extensions: 1015407 Number of successful extensions: 2228 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2227 Number of HSP's gapped (non-prelim): 1 length of query: 74 length of database: 189,106,746 effective HSP length: 49 effective length of query: 25 effective length of database: 159,780,883 effective search space: 3994522075 effective search space used: 3994522075 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)