BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs2503 30192 30413 74 !not a gene!
         (74 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||B71221 hypothetical protein PH0029 - Pyrococcus horikoshii ...    68  2e-11

>pir||B71221 hypothetical protein PH0029 - Pyrococcus horikoshii
          >gi|3256414|dbj|BAA29097.1| (AP000001) 114aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 114
          
 Score = 67.5 bits (162), Expect = 2e-11
 Identities = 32/65 (49%), Positives = 46/65 (70%)

Query: 10 PSPQMARPNVGRSVAQCVGSPTSRIPSWCLQSLDVNRELTSPPKDLAGPLNALSKNCSNT 69
          PSP++  PN+   +A+ V   + RIP    QSL+VNREL +P KDLAGPLN+LS++ ++T
Sbjct: 5  PSPEVTCPNICSCIAKPVSPSSPRIPGRGFQSLNVNRELATPSKDLAGPLNSLSEHRTDT 64

Query: 70 FPLSY 74
          FP  +
Sbjct: 65 FPFRH 69


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.317    0.131    0.408 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29226662
Number of Sequences: 2977
Number of extensions: 1015407
Number of successful extensions: 2228
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2227
Number of HSP's gapped (non-prelim): 1
length of query: 74
length of database: 189,106,746
effective HSP length: 49
effective length of query: 25
effective length of database: 159,780,883
effective search space: 3994522075
effective search space used: 3994522075
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 156 (65.2 bits)