BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs2999 209155 209310 52 !not a gene!
         (52 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||E71245 hypothetical protein PHS003 - Pyrococcus horikoshii ...   108  6e-24

>pir||E71245 hypothetical protein PHS003 - Pyrococcus horikoshii
          >gi|3256609|dbj|BAA29292.1| (AP000001) 52aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 52
          
 Score =  108 bits (268), Expect = 6e-24
 Identities = 52/52 (100%), Positives = 52/52 (100%)

Query: 1  MGSLAGAARPRKGIGGALRSAQAGQESAVECKGKSRPDWTRNRGGSSPERVA 52
          MGSLAGAARPRKGIGGALRSAQAGQESAVECKGKSRPDWTRNRGGSSPERVA
Sbjct: 1  MGSLAGAARPRKGIGGALRSAQAGQESAVECKGKSRPDWTRNRGGSSPERVA 52


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.310    0.128    0.376 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19429853
Number of Sequences: 2977
Number of extensions: 528553
Number of successful extensions: 986
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 985
Number of HSP's gapped (non-prelim): 1
length of query: 52
length of database: 189,106,746
effective HSP length: 31
effective length of query: 21
effective length of database: 170,553,649
effective search space: 3581626629
effective search space used: 3581626629
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 42 (21.7 bits)
S2: 156 (65.2 bits)