BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs3369 327535 327714 60 !not a gene! (60 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71185 hypothetical protein PH1760 - Pyrococcus horikoshii ... 70 2e-12 >pir||C71185 hypothetical protein PH1760 - Pyrococcus horikoshii >gi|3258191|dbj|BAA30874.1| (AP000007) 177aa long hypothetical protein [Pyrococcus horikoshii] Length = 177 Score = 70.2 bits (169), Expect = 2e-12 Identities = 34/56 (60%), Positives = 38/56 (67%) Query: 5 LFLFMSNSGPVSALTFYGLFLYDPFLYEPPNVFPCYSRGNVINPLWIYPYPILATL 60 L LFM P+SAL YG F YDPFL +PPN+FP Y N IN L I P+PILATL Sbjct: 66 LLLFMPYPSPISALPLYGFFPYDPFLNKPPNIFPRYRGSNFINLLRIDPHPILATL 121 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.150 0.510 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27807980 Number of Sequences: 2977 Number of extensions: 989628 Number of successful extensions: 1893 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1892 Number of HSP's gapped (non-prelim): 1 length of query: 60 length of database: 189,106,746 effective HSP length: 39 effective length of query: 21 effective length of database: 165,765,753 effective search space: 3481080813 effective search space used: 3481080813 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)