BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs3696 428343 428630 96 !not a gene! (96 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75155 hypothetical protein PAB2083 - Pyrococcus abyssi (st... 102 8e-22 >pir||A75155 hypothetical protein PAB2083 - Pyrococcus abyssi (strain Orsay) >gi|5457830|emb|CAB49320.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 103 Score = 102 bits (252), Expect = 8e-22 Identities = 55/90 (61%), Positives = 69/90 (76%), Gaps = 2/90 (2%) Query: 9 LKRLLLRALNENQILILKSI--NGKHRSLNALLEELSRKERKPLSTLKLNARILKELGLI 66 L++LL RALNENQ LIL S+ NG+ +SL +L E +S+ RKP+STLKLNA+ILKELGLI Sbjct: 13 LRKLLERALNENQRLILCSLDNNGESKSLTSLAEGISKAHRKPVSTLKLNAKILKELGLI 72 Query: 67 EYGTREAPKPVTLTREGKFILSILEGDGFE 96 EYGTR +P+ V LT GKF++ IL D E Sbjct: 73 EYGTRRSPRTVRLTEFGKFVIRILGADEVE 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.139 0.368 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32996747 Number of Sequences: 2977 Number of extensions: 1086997 Number of successful extensions: 3391 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3389 Number of HSP's gapped (non-prelim): 1 length of query: 96 length of database: 189,106,746 effective HSP length: 55 effective length of query: 41 effective length of database: 156,189,961 effective search space: 6403788401 effective search space used: 6403788401 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 158 (66.0 bits)