BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs3752 449032 449268 79 !not a gene! (79 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D72465 hypothetical protein APE2367 - Aeropyrum pernix (str... 78 1e-14 >pir||D72465 hypothetical protein APE2367 - Aeropyrum pernix (strain K1) >gi|5106069|dbj|BAA81380.1| (AP000064) 112aa long hypothetical protein [Aeropyrum pernix] Length = 112 Score = 78.4 bits (190), Expect = 1e-14 Identities = 44/76 (57%), Positives = 51/76 (66%) Query: 4 PYPMSLHLEPICLLIATLSPGSAQTGICSFTSISSFPRPVTKPMVLAVPTFKSRTSFLFM 63 P PMSLHL I LL ATL+ G TG+ S TSISSFP VT P V+AVPT S L + Sbjct: 3 PQPMSLHLPIILLLRATLALGHVTTGLLSCTSISSFPALVTTPRVIAVPTESISISPLLI 62 Query: 64 GSTLSSCSVPTTLSSK 79 GSTL+S +PTT SS+ Sbjct: 63 GSTLASSFIPTTFSSR 78 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.132 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29090160 Number of Sequences: 2977 Number of extensions: 944453 Number of successful extensions: 2060 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2059 Number of HSP's gapped (non-prelim): 1 length of query: 79 length of database: 189,106,746 effective HSP length: 51 effective length of query: 28 effective length of database: 158,583,909 effective search space: 4440349452 effective search space used: 4440349452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 157 (65.6 bits)