BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs3831 481277 481543 89 !not a gene! (89 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71047 hypothetical protein PH1670 - Pyrococcus horikoshii ... 148 8e-36 >pir||F71047 hypothetical protein PH1670 - Pyrococcus horikoshii >gi|3258099|dbj|BAA30782.1| (AP000006) 102aa long hypothetical protein [Pyrococcus horikoshii] Length = 102 Score = 148 bits (371), Expect = 8e-36 Identities = 75/89 (84%), Positives = 81/89 (90%) Query: 1 MTWLMLNAAPPLASASSLVNITASIFTASLNCLACSTMAFPARESPTNTTRFGFVTLAIF 60 +TWL+L AAPPLASASS VNIT SIFTA LNCLACST+AFPA+ESPT TR GFVTLAIF Sbjct: 10 ITWLILKAAPPLASASSFVNITPSIFTAWLNCLACSTIAFPAKESPTKITRLGFVTLAIF 69 Query: 61 LISSIKFLLVSLLPAVSIRTTSIPLALAC 89 ISSI+FLLVSLLPAVSI+TTSIPLALAC Sbjct: 70 FISSIRFLLVSLLPAVSIKTTSIPLALAC 98 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.131 0.382 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26481730 Number of Sequences: 2977 Number of extensions: 734779 Number of successful extensions: 2741 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2740 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 189,106,746 effective HSP length: 53 effective length of query: 36 effective length of database: 157,386,935 effective search space: 5665929660 effective search space used: 5665929660 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 158 (66.0 bits)