BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs3833 481592 481768 59 !not a gene!
         (59 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||C72708 hypothetical protein APE1082 - Aeropyrum pernix (str...    66  6e-11

>pir||C72708 hypothetical protein APE1082 - Aeropyrum pernix (strain K1)
          >gi|5104752|dbj|BAA80067.1| (AP000060) 134aa long
          hypothetical protein [Aeropyrum pernix]
          Length = 134
          
 Score = 65.6 bits (157), Expect = 6e-11
 Identities = 32/55 (58%), Positives = 40/55 (72%)

Query: 5  TPTLFACSSSCSMAPALNVSLAAITTLNPFFFNQWASFAIVVVFPEPLKPTNKIT 59
          TP+  A ++SCS APAL VS AAIT + P F + +A+FAIVVVFP PL P N +T
Sbjct: 35 TPSFSAWTASCSWAPALKVSAAAITGVTPAFLSMYATFAIVVVFPVPLTPRNSMT 89


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.326    0.133    0.416 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22666294
Number of Sequences: 2977
Number of extensions: 642330
Number of successful extensions: 1295
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1294
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 189,106,746
effective HSP length: 38
effective length of query: 21
effective length of database: 166,364,240
effective search space: 3493649040
effective search space used: 3493649040
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 156 (65.2 bits)