BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs3833 481592 481768 59 !not a gene! (59 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C72708 hypothetical protein APE1082 - Aeropyrum pernix (str... 66 6e-11 >pir||C72708 hypothetical protein APE1082 - Aeropyrum pernix (strain K1) >gi|5104752|dbj|BAA80067.1| (AP000060) 134aa long hypothetical protein [Aeropyrum pernix] Length = 134 Score = 65.6 bits (157), Expect = 6e-11 Identities = 32/55 (58%), Positives = 40/55 (72%) Query: 5 TPTLFACSSSCSMAPALNVSLAAITTLNPFFFNQWASFAIVVVFPEPLKPTNKIT 59 TP+ A ++SCS APAL VS AAIT + P F + +A+FAIVVVFP PL P N +T Sbjct: 35 TPSFSAWTASCSWAPALKVSAAAITGVTPAFLSMYATFAIVVVFPVPLTPRNSMT 89 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.133 0.416 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22666294 Number of Sequences: 2977 Number of extensions: 642330 Number of successful extensions: 1295 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1294 Number of HSP's gapped (non-prelim): 1 length of query: 59 length of database: 189,106,746 effective HSP length: 38 effective length of query: 21 effective length of database: 166,364,240 effective search space: 3493649040 effective search space used: 3493649040 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)