BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4149 606915 607109 65 !not a gene! (65 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71028 hypothetical protein PH1518 - Pyrococcus horikoshii ... 116 2e-26 >pir||B71028 hypothetical protein PH1518 - Pyrococcus horikoshii >gi|3257943|dbj|BAA30626.1| (AP000006) 149aa long hypothetical protein [Pyrococcus horikoshii] Length = 149 Score = 116 bits (289), Expect = 2e-26 Identities = 57/65 (87%), Positives = 59/65 (90%) Query: 1 MKNSSRSASSMSALFPTLTTAERPIFSSIVHPIRAIPSAPLWLINAKGPGRTSVGPKVPF 60 +KNS RSASS+SALFPTLTTAE PIFSSIVHPIRAIP APLWLINA GPGRTSVGPKV F Sbjct: 6 LKNSRRSASSISALFPTLTTAESPIFSSIVHPIRAIPRAPLWLINANGPGRTSVGPKVAF 65 Query: 61 NLAGV 65 N AGV Sbjct: 66 NFAGV 70 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.130 0.384 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22179903 Number of Sequences: 2977 Number of extensions: 653626 Number of successful extensions: 1464 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1463 Number of HSP's gapped (non-prelim): 1 length of query: 65 length of database: 189,106,746 effective HSP length: 44 effective length of query: 21 effective length of database: 162,773,318 effective search space: 3418239678 effective search space used: 3418239678 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)