BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4349 671814 672086 91 !not a gene! (91 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71018 hypothetical protein PH1443 - Pyrococcus horikoshii ... 97 4e-20 >pir||F71018 hypothetical protein PH1443 - Pyrococcus horikoshii >gi|3257867|dbj|BAA30550.1| (AP000006) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 97.1 bits (238), Expect = 4e-20 Identities = 44/83 (53%), Positives = 54/83 (65%) Query: 1 MLYGSCYLSYNWIPSGKFHCIRMNYLRRAGAHYCMNLSSVPYQFSSKLYALHSRYASWDC 60 + Y YN I S K HCIRMNYL R H +NLSS+PYQFS +LYA +S Y SW+C Sbjct: 8 VFYKPSNFRYNGITSCKLHCIRMNYLSRTRRHDSVNLSSMPYQFSCQLYAFYSCYTSWNC 67 Query: 61 KNYFFANKFPALCSVDKLNVAEH 83 K+Y F NKF L +D LN+ +H Sbjct: 68 KDYLFTNKFSTLFGIDPLNMVKH 90 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.137 0.471 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37166138 Number of Sequences: 2977 Number of extensions: 1293112 Number of successful extensions: 2840 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2839 Number of HSP's gapped (non-prelim): 1 length of query: 91 length of database: 189,106,746 effective HSP length: 44 effective length of query: 47 effective length of database: 162,773,318 effective search space: 7650345946 effective search space used: 7650345946 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 159 (66.3 bits)