BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4483 705150 705311 54 !not a gene! (54 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71013 hypothetical protein PH1403 - Pyrococcus horikoshii ... 86 5e-17 >pir||E71013 hypothetical protein PH1403 - Pyrococcus horikoshii >gi|3257826|dbj|BAA30509.1| (AP000006) 109aa long hypothetical protein [Pyrococcus horikoshii] Length = 109 Score = 85.8 bits (209), Expect = 5e-17 Identities = 41/54 (75%), Positives = 43/54 (78%) Query: 1 MSSVIPPIISTEYNLGFSSKPPTKNHAKYGSILAPLSIFAKSVARALTLILFPD 54 +SSVIPP ISTEYN GFSS PPTKNHA+YG LAP I A SVA A TLILFPD Sbjct: 56 LSSVIPPTISTEYNFGFSSYPPTKNHARYGKYLAPFIILASSVANAFTLILFPD 109 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18565968 Number of Sequences: 2977 Number of extensions: 475055 Number of successful extensions: 1093 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1092 Number of HSP's gapped (non-prelim): 1 length of query: 54 length of database: 189,106,746 effective HSP length: 33 effective length of query: 21 effective length of database: 169,356,675 effective search space: 3556490175 effective search space used: 3556490175 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)