BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4586 734256 734492 79 !not a gene! (79 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71009 hypothetical protein PH1367 - Pyrococcus horikoshii ... 132 8e-31 >pir||A71009 hypothetical protein PH1367 - Pyrococcus horikoshii >gi|3257790|dbj|BAA30473.1| (AP000006) 176aa long hypothetical protein [Pyrococcus horikoshii] Length = 176 Score = 132 bits (328), Expect = 8e-31 Identities = 64/79 (81%), Positives = 70/79 (88%) Query: 1 MYCFLISSRVPTVLSFPFTMIPTLSASSSTSLSMWDEKKTVFPCFFCSNIMSFTSLAPWG 60 MYCF ISS VPTVLSFP T+IPTLSASSSTSLSMWDEKKTVFPCF CS I+SFTSLAP G Sbjct: 98 MYCFFISSSVPTVLSFPLTIIPTLSASSSTSLSMWDEKKTVFPCFLCSLIISFTSLAPSG 157 Query: 61 SKPLVGSSSINNSGSLIKA 79 S+PLVGSS I +SGS ++A Sbjct: 158 SRPLVGSSRIKSSGSFMRA 176 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.130 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26365758 Number of Sequences: 2977 Number of extensions: 782739 Number of successful extensions: 1993 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1992 Number of HSP's gapped (non-prelim): 1 length of query: 79 length of database: 189,106,746 effective HSP length: 50 effective length of query: 29 effective length of database: 159,182,396 effective search space: 4616289484 effective search space used: 4616289484 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 157 (65.6 bits)