BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4687 772133 772387 85 !not a gene! (85 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71005 hypothetical protein PH1336 - Pyrococcus horikoshii ... 105 6e-23 >pir||B71005 hypothetical protein PH1336 - Pyrococcus horikoshii >gi|3257759|dbj|BAA30442.1| (AP000006) 138aa long hypothetical protein [Pyrococcus horikoshii] Length = 138 Score = 105 bits (259), Expect = 6e-23 Identities = 50/60 (83%), Positives = 55/60 (91%) Query: 26 IVIAAFIVGLIPSSFKGRAPMATTKESGYSSFRASARTGVPPAPVPPPNPKVRKKMSTSS 85 +VIAA IVGLIPSSF G+APMATT+ESGYSSF ASARTGVPPAPVPPP PKV+K +STSS Sbjct: 1 MVIAALIVGLIPSSFNGKAPMATTRESGYSSFNASARTGVPPAPVPPPKPKVKKNISTSS 60 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.125 0.333 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28105109 Number of Sequences: 2977 Number of extensions: 1031656 Number of successful extensions: 9509 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9508 Number of HSP's gapped (non-prelim): 1 length of query: 85 length of database: 189,106,746 effective HSP length: 64 effective length of query: 21 effective length of database: 150,803,578 effective search space: 3166875138 effective search space used: 3166875138 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 155 (64.8 bits)