BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4772 794709 794960 84 !not a gene! (84 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71001 hypothetical protein PH1311 - Pyrococcus horikoshii ... 124 2e-28 >pir||H71001 hypothetical protein PH1311 - Pyrococcus horikoshii >gi|3257733|dbj|BAA30416.1| (AP000006) 160aa long hypothetical protein [Pyrococcus horikoshii] Length = 160 Score = 124 bits (308), Expect = 2e-28 Identities = 55/83 (66%), Positives = 71/83 (85%) Query: 2 LDRRKFEVVIEETVHGYDAPVIVLKYRGKYFLLDGHHRVLARKVLKLDFVEALVLEPLEP 61 L+RRK E+VIE+T+HGYDAPVIVL+Y GKY+LLDGHHR ARK LKL FVEA++L PL+P Sbjct: 73 LERRKLEIVIEKTIHGYDAPVIVLEYNGKYYLLDGHHRAYARKALKLGFVEAIILRPLKP 132 Query: 62 VDIKIEESVKRQRIRSIDDIIVK 84 + I IEESV++Q IR +DD+ ++ Sbjct: 133 IKINIEESVEKQGIRKLDDLRIR 155 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.147 0.408 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27829092 Number of Sequences: 2977 Number of extensions: 909518 Number of successful extensions: 2715 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2714 Number of HSP's gapped (non-prelim): 1 length of query: 84 length of database: 189,106,746 effective HSP length: 50 effective length of query: 34 effective length of database: 159,182,396 effective search space: 5412201464 effective search space used: 5412201464 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 157 (65.6 bits)