BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4789 800896 801147 84 !not a gene! (84 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A72493 hypothetical protein APE2584 - Aeropyrum pernix (str... 78 2e-14 >pir||A72493 hypothetical protein APE2584 - Aeropyrum pernix (strain K1) >gi|5106290|dbj|BAA81601.1| (AP000064) 132aa long hypothetical protein [Aeropyrum pernix] Length = 132 Score = 77.6 bits (188), Expect = 2e-14 Identities = 35/61 (57%), Positives = 43/61 (70%) Query: 24 LASVRGKPTLSRTIASIMAPAPGTPAVPIEAKTAVRTIVNCWPRVRCIPRALAMKKVQTP 83 + SVR +P SRT+ASI+ PAPGTPAVP++A A R I +CWP R IPR AMK+ T Sbjct: 1 MGSVRERPRASRTMASIINPAPGTPAVPMDASVAARIIESCWPMDRSIPRVFAMKRAATA 60 Query: 84 W 84 W Sbjct: 61 W 61 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.132 0.405 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25873379 Number of Sequences: 2977 Number of extensions: 865298 Number of successful extensions: 5429 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5428 Number of HSP's gapped (non-prelim): 1 length of query: 84 length of database: 189,106,746 effective HSP length: 50 effective length of query: 34 effective length of database: 159,182,396 effective search space: 5412201464 effective search space used: 5412201464 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 157 (65.6 bits)