BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs4789 800896 801147 84 !not a gene!
         (84 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A72493 hypothetical protein APE2584 - Aeropyrum pernix (str...    78  2e-14

>pir||A72493 hypothetical protein APE2584 - Aeropyrum pernix (strain K1)
          >gi|5106290|dbj|BAA81601.1| (AP000064) 132aa long
          hypothetical protein [Aeropyrum pernix]
          Length = 132
          
 Score = 77.6 bits (188), Expect = 2e-14
 Identities = 35/61 (57%), Positives = 43/61 (70%)

Query: 24 LASVRGKPTLSRTIASIMAPAPGTPAVPIEAKTAVRTIVNCWPRVRCIPRALAMKKVQTP 83
          + SVR +P  SRT+ASI+ PAPGTPAVP++A  A R I +CWP  R IPR  AMK+  T 
Sbjct: 1  MGSVRERPRASRTMASIINPAPGTPAVPMDASVAARIIESCWPMDRSIPRVFAMKRAATA 60

Query: 84 W 84
          W
Sbjct: 61 W 61


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.324    0.132    0.405 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25873379
Number of Sequences: 2977
Number of extensions: 865298
Number of successful extensions: 5429
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5428
Number of HSP's gapped (non-prelim): 1
length of query: 84
length of database: 189,106,746
effective HSP length: 50
effective length of query: 34
effective length of database: 159,182,396
effective search space: 5412201464
effective search space used: 5412201464
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.6 bits)
S2: 157 (65.6 bits)