BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs4957 854534 854662 43 !not a gene! (43 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71074 hypothetical protein PH1286 - Pyrococcus horikoshii ... 75 8e-14 >pir||C71074 hypothetical protein PH1286 - Pyrococcus horikoshii >gi|3257706|dbj|BAA30389.1| (AP000005) 113aa long hypothetical protein [Pyrococcus horikoshii] Length = 113 Score = 75.3 bits (182), Expect = 8e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Query: 1 MESPHSGILPCFLGGSLTLLFSKASRAMTILALVSAGSITSSM 43 M SPHSG+ PCF GGSLTLLFSKASRAMTI ALVSAGS+TSSM Sbjct: 1 MFSPHSGMFPCFFGGSLTLLFSKASRAMTIFALVSAGSMTSSM 43 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.131 0.359 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11732766 Number of Sequences: 2977 Number of extensions: 233255 Number of successful extensions: 472 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 471 Number of HSP's gapped (non-prelim): 1 length of query: 43 length of database: 189,106,746 effective HSP length: 22 effective length of query: 21 effective length of database: 175,940,032 effective search space: 3694740672 effective search space used: 3694740672 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 156 (65.2 bits)