BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs5119 918299 918430 44 !not a gene!
         (44 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||F71095 hypothetical protein PH1027 - Pyrococcus horikoshii ...    69  8e-12

>pir||F71095 hypothetical protein PH1027 - Pyrococcus horikoshii
          >gi|3257441|dbj|BAA30124.1| (AP000004) 110aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 110
          
 Score = 68.7 bits (165), Expect = 8e-12
 Identities = 33/37 (89%), Positives = 35/37 (94%)

Query: 8  MYSICLTYFSKVGFSLSTNSGIATAPITPSLSAIAFI 44
          MYSICLTYFS+VG SLST +GIATAPITPSLSAIAFI
Sbjct: 1  MYSICLTYFSRVGLSLSTKAGIATAPITPSLSAIAFI 37


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.322    0.131    0.376 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14093719
Number of Sequences: 2977
Number of extensions: 311106
Number of successful extensions: 934
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 933
Number of HSP's gapped (non-prelim): 1
length of query: 44
length of database: 189,106,746
effective HSP length: 23
effective length of query: 21
effective length of database: 175,341,545
effective search space: 3682172445
effective search space used: 3682172445
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.5 bits)
S2: 156 (65.2 bits)