BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs5155 934341 934592 84 !not a gene!
         (84 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||B71093 hypothetical protein PH1007 - Pyrococcus horikoshii ...   125  1e-28

>pir||B71093 hypothetical protein PH1007 - Pyrococcus horikoshii
          >gi|3257421|dbj|BAA30104.1| (AP000004) 161aa long
          hypothetical protein [Pyrococcus horikoshii]
          Length = 161
          
 Score =  125 bits (310), Expect = 1e-28
 Identities = 61/68 (89%), Positives = 63/68 (91%)

Query: 1  MATAPGPSSSLTFKLTYFNPSGVFGIPLFSASSLIASPIETTGIPSFLNALATSPFPEPG 60
          +ATAPGPSSSLTFKLTYFNPSGVFGIPLFSASSLIASPIE TGIP  LNA ATSPFPEPG
Sbjct: 19 IATAPGPSSSLTFKLTYFNPSGVFGIPLFSASSLIASPIEITGIPLLLNAFATSPFPEPG 78

Query: 61 IPVKRIII 68
          IP KRII+
Sbjct: 79 IPTKRIIM 86


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33239730
Number of Sequences: 2977
Number of extensions: 1245489
Number of successful extensions: 2752
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2751
Number of HSP's gapped (non-prelim): 1
length of query: 84
length of database: 189,106,746
effective HSP length: 51
effective length of query: 33
effective length of database: 158,583,909
effective search space: 5233268997
effective search space used: 5233268997
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 157 (65.6 bits)