BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs5341 986026 986217 64 !not a gene! (64 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71066 hypothetical protein PH1225 - Pyrococcus horikoshii ... 80 2e-15 >pir||C71066 hypothetical protein PH1225 - Pyrococcus horikoshii >gi|3257642|dbj|BAA30325.1| (AP000005) 173aa long hypothetical protein [Pyrococcus horikoshii] Length = 173 Score = 80.4 bits (195), Expect = 2e-15 Identities = 36/57 (63%), Positives = 45/57 (78%) Query: 1 MLLLPIVYWISVLHYIGEEELFLREKFGEEWEEYSRKTPRFIPKLFELPRKHCNGER 57 ML LP+VYWIS+L+YI EEE FL +FG+EWEEY+ + PRFIP LFE+ +K GER Sbjct: 116 MLGLPVVYWISILYYIEEEERFLHVRFGKEWEEYASRVPRFIPNLFEVIKKLDPGER 172 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.146 0.468 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28779718 Number of Sequences: 2977 Number of extensions: 1029714 Number of successful extensions: 1890 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1889 Number of HSP's gapped (non-prelim): 1 length of query: 64 length of database: 189,106,746 effective HSP length: 43 effective length of query: 21 effective length of database: 163,371,805 effective search space: 3430807905 effective search space used: 3430807905 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 156 (65.2 bits)