BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs5535 1052330 1052560 77 !not a gene! (77 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71056 hypothetical protein PH1147 - Pyrococcus horikoshii ... 127 3e-29 >pir||E71056 hypothetical protein PH1147 - Pyrococcus horikoshii >gi|3257564|dbj|BAA30247.1| (AP000005) 108aa long hypothetical protein [Pyrococcus horikoshii] Length = 108 Score = 127 bits (315), Expect = 3e-29 Identities = 60/75 (80%), Positives = 67/75 (89%) Query: 1 MPLIAGGLLMSLVVTYCKNLRASFPLKYISPIWDTSNSPTAFLTAKCSSFMLEYHIGISQ 60 +PLIAGGLL+S VVTYC+N +AS PL ISP+ +TSN PTAFLTA+CSSFMLEYHIGIS Sbjct: 21 VPLIAGGLLISFVVTYCRNFKASLPLNTISPMCETSNIPTAFLTARCSSFMLEYHIGISH 80 Query: 61 PANSSIFLACSLCQS 75 PANSSIFLACSLCQS Sbjct: 81 PANSSIFLACSLCQS 95 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.134 0.416 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28536285 Number of Sequences: 2977 Number of extensions: 916651 Number of successful extensions: 2220 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2219 Number of HSP's gapped (non-prelim): 1 length of query: 77 length of database: 189,106,746 effective HSP length: 48 effective length of query: 29 effective length of database: 160,379,370 effective search space: 4651001730 effective search space used: 4651001730 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 157 (65.6 bits)