BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs5604 1079888 1080148 87 !not a gene! (87 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75050 hypothetical protein PAB1452 - Pyrococcus abyssi (st... 98 3e-20 >pir||H75050 hypothetical protein PAB1452 - Pyrococcus abyssi (strain Orsay) >gi|5458814|emb|CAB50301.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 404 Score = 97.5 bits (239), Expect = 3e-20 Identities = 49/71 (69%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Query: 14 LNLMGSFPFGPKANEPLAEDPVGLMMLVVEANPLHHRDALIIATKIGAGRNGLKFLL--- 70 LNL+G FPF PKANEPLAEDPVGLMMLVVEAN LHHR+ALIIATK GAG NG K ++ Sbjct: 324 LNLLGLFPFSPKANEPLAEDPVGLMMLVVEANLLHHRNALIIATKTGAGGNGKKNIILAW 383 Query: 71 PVNKFSNLHNI 81 ++ F +L+N+ Sbjct: 384 DLDDFKSLNNV 394 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.140 0.413 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32404562 Number of Sequences: 2977 Number of extensions: 1119396 Number of successful extensions: 1530 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1529 Number of HSP's gapped (non-prelim): 1 length of query: 87 length of database: 189,106,746 effective HSP length: 49 effective length of query: 38 effective length of database: 159,780,883 effective search space: 6071673554 effective search space used: 6071673554 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 158 (66.0 bits)