BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs5687 1117930 1118118 63 !not a gene!
         (63 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||G71148 probable glycosyl transferase - Pyrococcus horikoshi...    66  4e-11

>pir||G71148 probable glycosyl transferase - Pyrococcus horikoshii
           >gi|3256793|dbj|BAA29476.1| (AP000002) 294aa long
           hypothetical glycosyl transferase [Pyrococcus
           horikoshii]
           Length = 294
           
 Score = 66.3 bits (159), Expect = 4e-11
 Identities = 30/57 (52%), Positives = 41/57 (71%)

Query: 3   EIINSHPEIKNNPKVLSYHLLQIGLLKLFSGDKTGARDIINSLGPNLLSKENLMDVL 59
           ++I  H +IK NP+VLSYHLLQIG+LKLFSGDK G  D++ +   N   + N+ D+L
Sbjct: 219 KMIEKHLDIKRNPRVLSYHLLQIGVLKLFSGDKRGVEDLLKAFRLNPTIRGNIWDIL 275


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.317    0.142    0.399 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23888964
Number of Sequences: 2977
Number of extensions: 774380
Number of successful extensions: 1576
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1575
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 189,106,746
effective HSP length: 42
effective length of query: 21
effective length of database: 163,970,292
effective search space: 3443376132
effective search space used: 3443376132
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.5 bits)
S2: 156 (65.2 bits)