BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs5687 1117930 1118118 63 !not a gene! (63 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71148 probable glycosyl transferase - Pyrococcus horikoshi... 66 4e-11 >pir||G71148 probable glycosyl transferase - Pyrococcus horikoshii >gi|3256793|dbj|BAA29476.1| (AP000002) 294aa long hypothetical glycosyl transferase [Pyrococcus horikoshii] Length = 294 Score = 66.3 bits (159), Expect = 4e-11 Identities = 30/57 (52%), Positives = 41/57 (71%) Query: 3 EIINSHPEIKNNPKVLSYHLLQIGLLKLFSGDKTGARDIINSLGPNLLSKENLMDVL 59 ++I H +IK NP+VLSYHLLQIG+LKLFSGDK G D++ + N + N+ D+L Sbjct: 219 KMIEKHLDIKRNPRVLSYHLLQIGVLKLFSGDKRGVEDLLKAFRLNPTIRGNIWDIL 275 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.142 0.399 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23888964 Number of Sequences: 2977 Number of extensions: 774380 Number of successful extensions: 1576 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1575 Number of HSP's gapped (non-prelim): 1 length of query: 63 length of database: 189,106,746 effective HSP length: 42 effective length of query: 21 effective length of database: 163,970,292 effective search space: 3443376132 effective search space used: 3443376132 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.5 bits) S2: 156 (65.2 bits)