BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs5761 1141104 1141337 78 !not a gene! (78 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75097 polysaccharide biosynthesis related protein PAB0783 ... 84 2e-16 >pir||H75097 polysaccharide biosynthesis related protein PAB0783 - Pyrococcus abyssi (strain Orsay) >gi|5458597|emb|CAB50085.1| (AJ248286) polysaccharide biosynthesis related protein [Pyrococcus abyssi] Length = 511 Score = 84.3 bits (205), Expect = 2e-16 Identities = 38/77 (49%), Positives = 60/77 (77%) Query: 1 MKPLIISFVLLGLIQGLHLRVPNIWYAVPVLAVFLGVYFFLILLSRSVDKEDVELLLAVE 60 +KPL I +L+G+I+ +HL V NIWYA+ +L + L VY L+L+ +S+D+ED+EL+L +E Sbjct: 433 LKPLGIGVLLVGMIKAVHLNVGNIWYALILLGLILVVYSLLVLVVKSLDREDLELMLEIE 492 Query: 61 RKLGVDLKIIKKILRRF 77 +KLG++L I+K L+RF Sbjct: 493 KKLGLNLGILKNFLKRF 509 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.335 0.154 0.445 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25814176 Number of Sequences: 2977 Number of extensions: 847510 Number of successful extensions: 4218 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4217 Number of HSP's gapped (non-prelim): 1 length of query: 78 length of database: 189,106,746 effective HSP length: 46 effective length of query: 32 effective length of database: 161,576,344 effective search space: 5170443008 effective search space used: 5170443008 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.5 bits) S2: 157 (65.6 bits)