BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6151 1275275 1275523 83 !not a gene! (83 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71120 hypothetical protein PH0733 - Pyrococcus horikoshii ... 111 1e-24 >pir||F71120 hypothetical protein PH0733 - Pyrococcus horikoshii >gi|3257141|dbj|BAA29824.1| (AP000003) 150aa long hypothetical protein [Pyrococcus horikoshii] Length = 150 Score = 111 bits (276), Expect = 1e-24 Identities = 58/82 (70%), Positives = 65/82 (78%) Query: 1 MNMGFPLTRIISVVLSNSATLTSSFLFNIFPAISSPNIWESCAIIPFTSFLLSGCLTFSS 60 MN+G LTRIISVVLSNSATLTSSFL +IF AISSPNIW++ AII TSFLL+GC F+S Sbjct: 1 MNIGLSLTRIISVVLSNSATLTSSFLLSIFLAISSPNIWDNWAIISLTSFLLNGCFIFNS 60 Query: 61 NSLTPYFIVYFPCSFSRIWSVV 82 T YFIVY C FS IWSV+ Sbjct: 61 ILNTSYFIVYRFCCFSWIWSVI 82 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.138 0.440 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30429047 Number of Sequences: 2977 Number of extensions: 1018589 Number of successful extensions: 2470 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2469 Number of HSP's gapped (non-prelim): 1 length of query: 83 length of database: 189,106,746 effective HSP length: 46 effective length of query: 37 effective length of database: 161,576,344 effective search space: 5978324728 effective search space used: 5978324728 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 158 (66.0 bits)