BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6176 1282776 1283060 95 !not a gene! (95 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71118 hypothetical protein PH0719 - Pyrococcus horikoshii ... 100 5e-21 >pir||H71118 hypothetical protein PH0719 - Pyrococcus horikoshii >gi|3257127|dbj|BAA29810.1| (AP000003) 112aa long hypothetical protein [Pyrococcus horikoshii] Length = 112 Score = 99.8 bits (245), Expect = 5e-21 Identities = 49/56 (87%), Positives = 53/56 (94%) Query: 40 MVSLKLSPFLTLLVEASANPMTAPPKRCIALSKLNLVLVDGSKNSVARIFPFAYSS 95 MVSL+LSPFLTLLVEASANP+T PPKRCIALSKLNLVLVDGSKN+VA IFP AYS+ Sbjct: 1 MVSLRLSPFLTLLVEASANPITEPPKRCIALSKLNLVLVDGSKNNVANIFPLAYSN 56 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.130 0.367 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30004406 Number of Sequences: 2977 Number of extensions: 825974 Number of successful extensions: 2164 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2163 Number of HSP's gapped (non-prelim): 1 length of query: 95 length of database: 189,106,746 effective HSP length: 55 effective length of query: 40 effective length of database: 156,189,961 effective search space: 6247598440 effective search space used: 6247598440 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 158 (66.0 bits)