BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6190 1292986 1293234 83 !not a gene! (83 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71117 hypothetical protein PH0705 - Pyrococcus horikoshii ... 149 5e-36 >pir||B71117 hypothetical protein PH0705 - Pyrococcus horikoshii >gi|3257113|dbj|BAA29796.1| (AP000003) 170aa long hypothetical protein [Pyrococcus horikoshii] Length = 170 Score = 149 bits (372), Expect = 5e-36 Identities = 73/83 (87%), Positives = 80/83 (95%) Query: 1 MLTPKTPAGYRRSIANFFTSSVPLISLPSITLTLFPSSLVKYFMFFPPFPMTIGTSPSPT 60 MLTPKTPAGYRRSIA+FFTSSV LISLPSITLTL P+SLV+YF+FFPPFP+T+GTSPSPT Sbjct: 1 MLTPKTPAGYRRSIASFFTSSVLLISLPSITLTLLPNSLVRYFIFFPPFPITMGTSPSPT 60 Query: 61 ISTTRSPASTAFLNSMSASPSNL 83 I TTRSPASTAFLNSMSASPS+L Sbjct: 61 IRTTRSPASTAFLNSMSASPSSL 83 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.130 0.377 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33145823 Number of Sequences: 2977 Number of extensions: 1271304 Number of successful extensions: 5469 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5468 Number of HSP's gapped (non-prelim): 1 length of query: 83 length of database: 189,106,746 effective HSP length: 53 effective length of query: 30 effective length of database: 157,386,935 effective search space: 4721608050 effective search space used: 4721608050 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 157 (65.6 bits)