BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6259 1321486 1321734 83 !not a gene! (83 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71114 hypothetical protein PH0683 - Pyrococcus horikoshii ... 136 3e-32 >pir||D71114 hypothetical protein PH0683 - Pyrococcus horikoshii >gi|3257091|dbj|BAA29774.1| (AP000003) 107aa long hypothetical protein [Pyrococcus horikoshii] Length = 107 Score = 136 bits (340), Expect = 3e-32 Identities = 75/86 (87%), Positives = 77/86 (89%), Gaps = 3/86 (3%) Query: 1 MKVLTPAALAPTRAEIAECSLSTFMNSASNSPFATNSLIFSGTSVDGVIGNAAITFGLAS 60 MKVLTPAALAPT AEIAECSLSTFMNSAS+SPFATNSLIFSGT VDGVIGNAAIT G AS Sbjct: 1 MKVLTPAALAPTTAEIAECSLSTFMNSASSSPFATNSLIFSGTRVDGVIGNAAITLGFAS 60 Query: 61 LAAQAAASLAFITVLIGIFH---HLT 83 LAA AAASLAFITVLIGI + HLT Sbjct: 61 LAAHAAASLAFITVLIGIKNTPFHLT 86 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.129 0.352 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24599798 Number of Sequences: 2977 Number of extensions: 691310 Number of successful extensions: 2521 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2520 Number of HSP's gapped (non-prelim): 1 length of query: 83 length of database: 189,106,746 effective HSP length: 57 effective length of query: 26 effective length of database: 154,992,987 effective search space: 4029817662 effective search space used: 4029817662 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 156 (65.2 bits)