BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6784 1495788 1496054 89 !not a gene! (89 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71163 hypothetical protein PH0506 - Pyrococcus horikoshii ... 136 5e-32 >pir||E71163 hypothetical protein PH0506 - Pyrococcus horikoshii >gi|3256911|dbj|BAA29594.1| (AP000002) 123aa long hypothetical protein [Pyrococcus horikoshii] Length = 123 Score = 136 bits (339), Expect = 5e-32 Identities = 68/89 (76%), Positives = 72/89 (80%) Query: 1 MILLVGFKAFIAYCGIIESSEYWIFLNSSLGKDIKSLPLKIAEPPLYSIGGFLRIKEWTR 60 +I LVGF AFIAYCGII++S YWIFL SSL IKS PLKIA PPL IGGFLRI+EWTR Sbjct: 29 LIFLVGFNAFIAYCGIIDNSLYWIFLASSLESFIKSFPLKIAFPPLCVIGGFLRIREWTR 88 Query: 61 VDLPQPLSPATPKTSPSPTSKLTPSTALT 89 VD PQPLSPA P TSP TSKLTPSTA T Sbjct: 89 VDFPQPLSPAIPNTSPFLTSKLTPSTAFT 117 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.137 0.415 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37060670 Number of Sequences: 2977 Number of extensions: 1550624 Number of successful extensions: 12942 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12941 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 189,106,746 effective HSP length: 49 effective length of query: 40 effective length of database: 159,780,883 effective search space: 6391235320 effective search space used: 6391235320 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)