BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs6851 1512301 1512561 87 !not a gene! (87 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71160 hypothetical protein PH0485 - Pyrococcus horikoshii ... 146 2e-35 >pir||H71160 hypothetical protein PH0485 - Pyrococcus horikoshii >gi|3256890|dbj|BAA29573.1| (AP000002) 307aa long hypothetical protein [Pyrococcus horikoshii] Length = 307 Score = 146 bits (366), Expect = 2e-35 Identities = 75/87 (86%), Positives = 84/87 (96%) Query: 1 MSAPSMTNSTSLPIFLAKSLTILGNLLKTSAIGVNLISIISSCSSVSNLESVDNASNNSL 60 MSAPS+TNSTSLPIFLAKSLTILGNLLKTSAIGV+LISIISSC+SV +L++V+ ASNNSL Sbjct: 1 MSAPSITNSTSLPIFLAKSLTILGNLLKTSAIGVSLISIISSCNSVRSLDNVERASNNSL 60 Query: 61 SPNLSPICSSLPLVMTSSPTRFINLSK 87 SP+LSPICSSLP VMTSSPTRFI+LSK Sbjct: 61 SPSLSPICSSLPFVMTSSPTRFISLSK 87 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.310 0.123 0.321 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27403293 Number of Sequences: 2977 Number of extensions: 829946 Number of successful extensions: 2762 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2761 Number of HSP's gapped (non-prelim): 1 length of query: 87 length of database: 189,106,746 effective HSP length: 66 effective length of query: 21 effective length of database: 149,606,604 effective search space: 3141738684 effective search space used: 3141738684 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 155 (64.8 bits)